PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F02141.1.p
Common NameEUGRSUZ_F02141, LOC104449174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 24246.8 Da    PI: 9.0013
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F02141.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.23.8e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k+i+n + rqvtfskRr g++KKAeELSvLCda+v++i+fs tgkly++ss
  Eucgr.F02141.1.p  9 KKIDNLTARQVTFSKRRRGLIKKAEELSVLCDADVSLIVFSATGKLYDFSS 59
                      68***********************************************96 PP

2K-box49.32e-171031723099
             K-box  30 nLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                          +++R+++GedLe L+++eL qLe++Le +l+ + + K+e   ++i++lq+ke +l ++nk+L+++++
  Eucgr.F02141.1.p 103 DRAHKLRQMKGEDLEGLNVEELDQLEKKLEAGLSLVIKNKEEKTWNEINKLQRKEAQLIKQNKQLKHEMK 172
                       445789************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.072161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-30385IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-26323IPR002100Transcription factor, MADS-box
PfamPF003197.8E-241057IPR002100Transcription factor, MADS-box
CDDcd002657.77E-311275No hitNo description
PRINTSPR004048.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.62887177IPR002487Transcription factor, K-box
PfamPF014862.6E-1495171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MAKEKIKIKK IDNLTARQVT FSKRRRGLIK KAEELSVLCD ADVSLIVFSA TGKLYDFSSS  60
RMEDTLTRYY GFHSNKVEKS VQPCLALEIE NTNREMLHEE VYDRAHKLRQ MKGEDLEGLN  120
VEELDQLEKK LEAGLSLVIK NKEEKTWNEI NKLQRKEAQL IKQNKQLKHE MKMILHQEKS  180
VTVNSESVKD VYISRNSIPP LDGDSPNPSS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D3e-16269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-16269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-16269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-16269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S3e-16169169Myocyte-specific enhancer factor 2B
1tqe_R3e-16169169Myocyte-specific enhancer factor 2B
1tqe_Q3e-16169169Myocyte-specific enhancer factor 2B
1tqe_P3e-16169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F02141.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061527.11e-154PREDICTED: MADS-box protein JOINTLESS-like isoform X1
SwissprotQ9FUY62e-64JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLA0A059BQW41e-154A0A059BQW4_EUCGR; Uncharacterized protein
STRINGVIT_18s0001g07460.t011e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.16e-65MIKC_MADS family protein